DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxe1

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:361 Identity:111/361 - (30%)
Similarity:163/361 - (45%) Gaps:105/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134
            ||||||||||||||.|:.|:|:||.|||::|.||||:||||.:.|||||||||:||:||:|:.|:
 Frog    66 KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 130

  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMT 199
            ..:||||:||.|||::.:|||:|||||||:|||:.|                             
 Frog   131 PGRPGKGNYWALDPNAEDMFDSGSFLRRRKRFKRTD----------------------------- 166

  Fly   200 NGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLNSCHDSLAQMNHLAGGGVEHPGFT--V 262
                    :..:.|:     :.|....|..:|:.|...|:.:.::..          .|.::  :
 Frog   167 --------LTTYPAY-----IHDTSMFSPLQVARATYPNTVYPNMTM----------SPSYSQQI 208

  Fly   263 DSLMNVYNPR---IHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLTPG 324
            ....:||.|.   ...||.|...:.:.|          :.| :.:.||||..|.:       :|.
 Frog   209 APHSSVYYPSSSPAFSSAQPRVFSINTL----------IGH-SGSEHAQQPNRSI-------SPE 255

  Fly   325 GQGAGGQSSGHSPTTISTPHG-----PAHGGWYTPETPPS------EPVPHNGQQ--GT------ 370
            .......|..:..:|.|:..|     |.....|:...|.|      ...||:..|  |:      
 Frog   256 VNSTSSSSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSHLQMNQSSYPHSNAQLFGSASRLPM 320

  Fly   371 PTHPGHNNN-----------NSSSVLNHNGVGNGGG 395
            ||.|..|::           ..:|:..:|..|..||
 Frog   321 PTSPPMNSDAVDFYGRMSPGQYTSLTTYNSNGQLGG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.