DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxd7

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:203 Identity:84/203 - (41%)
Similarity:110/203 - (54%) Gaps:20/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GYGSASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQN 85
            |..|.......|..||:...|.. |:.:..|.|...    :.......|||||||||||.|||..
Zfish    20 GKDSGDEHLLTSPLSASDQVHNK-DEENHVPSSICP----SSSSKSSSVKPPYSYIALITMAILQ 79

  Fly    86 AADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDS 150
            :..|::||:.|..:|..||.|||:....||||||||||||:||||:.|:...||||:||||||:|
Zfish    80 SPKKRLTLSEICDFISHRFVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNS 144

  Fly   151 YNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHF 215
            .:||:||||||||:|||::..   |....|.||:.......:.         ..|..::|..||.
Zfish   145 SDMFENGSFLRRRKRFKRQHF---KFGVFKDQALQPSGFPNLS---------YGAYGLSASCAHL 197

  Fly   216 KKEPLMDL 223
               |.:|:
Zfish   198 ---PALDV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 53/85 (62%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 50/82 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.