DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl2l

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001122282.1 Gene:foxl2l / 100004081 ZFINID:ZDB-GENE-081022-71 Length:260 Species:Danio rerio


Alignment Length:309 Identity:98/309 - (31%)
Similarity:135/309 - (43%) Gaps:80/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAPHQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSL 124
            |.|.......||||||:|||||||:.:.|||:|||.||.||:.:||||..||:||||||||||||
Zfish    25 GCPGAAPAPEKPPYSYVALIAMAIRESEDKKLTLNDIYSYIISKFPYYEKNKKGWQNSIRHNLSL 89

  Fly   125 NECFVKVARDDKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMMNEKL 189
            ||||||:.|:.....||::|||||...:||:.|::.||||              :||        
Zfish    90 NECFVKIPRESGGERKGNFWTLDPAFNDMFEKGNYRRRRR--------------VKR-------- 132

  Fly   190 AEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVS--HAA--MLNSCHDSLAQMNHL 250
             ..:|..|.:.......:.......:.:.|.:..|..|....|  |.:  ||.:...  ...|..
Zfish   133 -PYRPAALPSGYNFADPYCLQQEPVYWQSPFVSSGSWSHHSGSPTHISSYMLGNARP--LSPNDF 194

  Fly   251 AGGGVEHPGFTVDSLMNVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVA 315
            |...|        |..:.::|..|.|..|||.:.:.|..::.                       
Zfish   195 ANSPV--------SYYHGHHPHFHPSYRPYHRHPNALVPLSG----------------------- 228

  Fly   316 HVAHPLTPGGQGAGGQSSGHSPTTISTPHGPAHGGWYTPETPPSEPVPH 364
             :..|::|||            ::|||..       |.|:....|.|.|
Zfish   229 -MTPPVSPGG------------SSISTCS-------YAPQNSHPELVHH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 57/85 (67%)
foxl2lNP_001122282.1 Forkhead 35..121 CDD:278670 57/85 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.