DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment croc and foxl3

DIOPT Version :9

Sequence 1:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001182055.1 Gene:foxl3 / 100003253 ZFINID:ZDB-GENE-121214-362 Length:220 Species:Danio rerio


Alignment Length:255 Identity:95/255 - (37%)
Similarity:129/255 - (50%) Gaps:65/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SRYPYSASAY-GLGAP----HQNKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYY 107
            |:|||:...| |.|.|    .:.|::.:|.||||||||||||.:.:.||||:|||::||:|||||
Zfish     6 SQYPYNCFNYDGEGYPSCGTDEEKKVCRPAYSYIALIAMAIQQSPENKVTLSGIYEFIMKRFPYY 70

  Fly   108 RDNKQGWQNSIRHNLSLNECFVKVAR-DDKKPGKGSYWTLDPDSYNM---FDNGSFLRRRRRFKK 168
            |.|::.||||||||||||.||:||.| :..:.|||:|||......:|   |:||:|.|||||...
Zfish    71 RSNQRAWQNSIRHNLSLNSCFIKVPRTEGNEKGKGNYWTFATGCESMLDLFENGNFRRRRRRRNL 135

  Fly   169 KDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSH 233
            |..::|..||.                          ..|.||.|                    
Zfish   136 KMGLKEPTEAF--------------------------ISMDAHQA-------------------- 154

  Fly   234 AAMLNSCHDSLAQMNHLAGGGVEHP--GFTVDSLMNVYNP----RIHHSAYPY----HLN 283
            .|:.:|..||....:|.|.......  .|::|.:::..:|    |..:||.|:    |||
Zfish   155 VAVRSSDSDSFMNTSHRAAQNKPETEIKFSIDYILSTPDPLPAFRAPNSAIPHLEPQHLN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crocNP_524202.1 Forkhead 70..156 CDD:278670 54/89 (61%)
foxl3NP_001182055.1 Forkhead 33..119 CDD:278670 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.