DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and STX8

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_004844.1 Gene:STX8 / 9482 HGNCID:11443 Length:236 Species:Homo sapiens


Alignment Length:255 Identity:62/255 - (24%)
Similarity:100/255 - (39%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQ-PLLDNDRHSPNHNHS 147
            ||.| |..:..|.|      :.|.::::..:||.:.      |.::.|| ..|:.||        
Human    35 EKAP-KLTVTIRAL------LQNLKEKIALLKDLLL------RAVSTHQITQLEGDR-------- 78

  Fly   148 IAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSK 212
                    ..|........:|..|.      |..|.|::.....:..||..|...:.:..     
Human    79 --------RQNLLDDLVTRERLLLA------SFKNEGAEPDLIRSSLMSEEAKRGAPNPW----- 124

  Fly   213 LENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVE 277
               ..:.|.   :|...|.|        |....||::||.||..||.:|..|...|.:.::||.|
Human   125 ---LFEEPE---ETRGLGFD--------EIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNE 175

  Fly   278 LDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFI 337
            ||||..::||..|..:.|:.||....::|..|     |::..:..:|:..|||.|.|:.:
Human   176 LDEQNEIIDDLANLVENTDEKLRNETRRVNMV-----DRKSASCGMIMVILLLLVAIVVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 7/30 (23%)
SNARE_Syntaxin6 250..315 CDD:277204 24/64 (38%)
STX8NP_004844.1 SNARE_Syntaxin8 152..204 CDD:277205 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154217
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.