DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and STX10

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_003756.1 Gene:STX10 / 8677 HGNCID:11428 Length:249 Species:Homo sapiens


Alignment Length:322 Identity:116/322 - (36%)
Similarity:157/322 - (48%) Gaps:84/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PF--PNSEVFKALNKTRGLYLRWRELGEN----GGTEAEWTTTELRNSLRSIEWDLEDLEDTISI 82
            ||  ...||.||:|..||||.||.||.:.    |..|.:|||.||||.||||||||||||:||.|
Human     6 PFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGI 70

  Fly    83 VEKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHS 147
            ||.||.||::...:|..|:.|::..|:.|::|||.|.                     ||.   :
Human    71 VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMV---------------------SPT---A 111

  Fly   148 IAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSK 212
            :|....|                       |..|.:|...|......:..|:|.           
Human   112 VAFLERN-----------------------NREILAGKPAAQKSPSDLLDASAV----------- 142

  Fly   213 LENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVE 277
                                |.:.||:.|..:.||.::..||:||:|:|.||..||.:|.::|.|
Human   143 --------------------SATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEE 187

  Fly   278 LDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFIIL 339
            ||||.:|||.|..|.|.|:|::|..::|:|||.||.:|:|||.||.:|.|:||.|:||...|
Human   188 LDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 48/89 (54%)
SNARE_Syntaxin6 250..315 CDD:277204 32/64 (50%)
STX10NP_003756.1 Syntaxin-6_N 13..103 CDD:286286 48/89 (54%)
SNARE_Syntaxin6 160..225 CDD:277204 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154219
Domainoid 1 1.000 104 1.000 Domainoid score I6700
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3650
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53942
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 1 1.000 - - FOG0003084
OrthoInspector 1 1.000 - - otm42236
orthoMCL 1 0.900 - - OOG6_101619
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1528
SonicParanoid 1 1.000 - - X3993
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.