DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and VAM7

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_011303.1 Gene:VAM7 / 852660 SGDID:S000003180 Length:316 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:60/311 - (19%)
Similarity:111/311 - (35%) Gaps:65/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VFSFISLPFPNSEVFKALNKTRGLYLRWR------ELGENGGTEAEWTTTELRNSLRSIEW-DLE 74
            |.|.|...||        .|...|..||:      |:.:......|....||.|......| |.:
Yeast    56 VGSTIPYDFP--------EKPGVLDRRWQRRYDDPEMIDERRIGLERFLNELYNDRFDSRWRDTK 112

  Fly    75 DLEDTISIVEKNPSKFRIDNRELSSRRHFIDNTRDEV---KQMKD-KMSLNRSRDRDITAHQPLL 135
            ..:|.:.:.:.|.|:.:       |::|.  .|.|||   :.::| |:.|::..|...:....|.
Yeast   113 IAQDFLQLSKPNVSQEK-------SQQHL--ETADEVGWDEMIRDIKLDLDKESDGTPSVRGALR 168

  Fly   136 DNDR-HSPNHNHSIAIPNSNSNSNEYHQHPHNDRTYLVECPN-GNSLINSGSQVANTIAGTMSAA 198
            ...: |.........:...:..|.|..:.....|:.|.||.: |.:.|   :|....:.|..::.
Yeast   169 ARTKLHKLRERLEQDVQKKSLPSTEVTRRAALLRSLLKECDDIGTANI---AQDRGRLLGVATSD 230

  Fly   199 AAAASRHSGTKYSKLENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDS 263
            .::.:...|...:.|:..                             |.:|::.|:::|..:...
Yeast   231 NSSTTEVQGRTNNDLQQG-----------------------------QMQMVRDQEQELVALHRI 266

  Fly   264 IGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNN 314
            |...:.::.::..||..|..:|....::.|.|..:|....||..   |.||
Yeast   267 IQAQRGLALEMNEELQTQNELLTALEDDVDNTGRRLQIANKKAR---HFNN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 20/95 (21%)
SNARE_Syntaxin6 250..315 CDD:277204 15/65 (23%)
VAM7NP_011303.1 PX_SNARE 13..120 CDD:132807 17/71 (24%)
SNARE_VAM7 253..311 CDD:277211 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.