DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and SYN8

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_009388.2 Gene:SYN8 / 851219 SGDID:S000000012 Length:255 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:35/143 - (24%)
Similarity:59/143 - (41%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SRHSGTKYSKLENALDSPSHYGQTHHGGMDSPSHRYVG--ETVSIQQRMIQGQDEQLDMISDSIG 265
            |.|:..|...|::.|.|.|         ...|....|.  |....||:.:..||..|..:|.|||
Yeast   127 STHTPYKDEPLQSQLQSQS---------QPQPPQPMVSNQELFINQQQQLLEQDSHLGALSQSIG 182

  Fly   266 TLKTVSRQIGVEL-DEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKR---QWAAILILS 326
            ....:|..:..|: .:...:|.|..|..|.....|:    :.::.:|..|:.|   ....::|  
Yeast   183 RTHDISLDLNNEIVSQNDSLLVDLENLIDNNGRNLN----RASRSMHGFNNSRFKDNGNCVII-- 241

  Fly   327 GLLLFVIILFIIL 339
             |:|.|::|.::|
Yeast   242 -LVLIVVLLLLLL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286
SNARE_Syntaxin6 250..315 CDD:277204 15/65 (23%)
SYN8NP_009388.2 SNARE_SYN8 167..236 CDD:277212 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.