DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and SYP61

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_564310.1 Gene:SYP61 / 839749 AraportID:AT1G28490 Length:245 Species:Arabidopsis thaliana


Alignment Length:318 Identity:74/318 - (23%)
Similarity:131/318 - (41%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PF--PNSEVFKALNKTRGLYLRWRELGENGGTEAEWTTTELRNSLRSIEWDLEDLEDTISIVEKN 86
            ||  ...|:..:::|.:..:.:|..:..:.|.:|. ...||..:..||||.:::||..|::..|:
plant     7 PFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAH-VAKELVATCGSIEWQVDELEKAITVAAKD 70

  Fly    87 PSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHSIAIP 151
            ||.:.||..||..||.:..|.|.:|:.:|                                    
plant    71 PSWYGIDEAELEKRRRWTSNARTQVRNVK------------------------------------ 99

  Fly   152 NSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSKLENA 216
                                                :..:||.:|:.|..|| ....:..::.|:
plant   100 ------------------------------------SGVLAGKVSSGAGHAS-EVRRELMRMPNS 127

  Fly   217 LDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVELDEQ 281
            .:: |.|.|  :||.|...  :|......|..:|:.|||:||.:|.|:..:..|...|..||..|
plant   128 GEA-SRYDQ--YGGRDDDG--FVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLTIHDELVAQ 187

  Fly   282 AVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFIIL 339
            ..::|:...|.|:|:::|:...|||..|:.....|.|   ::::..||:..||||:::
plant   188 ERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQ---MMMICFLLVLFIILFVLV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 26/85 (31%)
SNARE_Syntaxin6 250..315 CDD:277204 22/64 (34%)
SYP61NP_564310.1 SNARE_NTD_AtSYP61-like 5..102 CDD:410571 29/167 (17%)
SNARE_Qc 156..212 CDD:277194 19/55 (35%)
SNARE 189..240 CDD:399038 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4024
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115622
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53942
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 1 1.000 - - FOG0003084
OrthoInspector 1 1.000 - - oto3102
orthoMCL 1 0.900 - - OOG6_101619
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.