DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and AT1G16230

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001319019.1 Gene:AT1G16230 / 838192 AraportID:AT1G16230 Length:193 Species:Arabidopsis thaliana


Alignment Length:213 Identity:40/213 - (18%)
Similarity:86/213 - (40%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VKQMKDKMSLNRSRDRDITAHQPLLDND----RHSPNHNHSIAIPNSNSNSNEYHQHPHNDRTYL 171
            :::..:.:.|:...|..|.....|.:..    ||:.:....|.|..:...:.:          ||
plant     9 IREQNETLKLSEEIDGMILERSSLAETSSYALRHASSMRRKITILATRVQTLK----------YL 63

  Fly   172 VECPNGNSLINSGSQVA---NTIAGTMSAAAAAASRHSGTKYSKLENALDSPSHYGQTHHGGMDS 233
            :....|.|:  ||.:::   .|.....|.|...||.....|:|.::..|........:...|:|:
plant    64 LAESQGKSI--SGKEMSRRKGTFENLRSKANQMASALDMLKFSNIDILLRPEKDDIMSRVIGLDN 126

  Fly   234 PSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLK----TVSRQIGVELDEQAVMLDDFGNEFDT 294
            ..      .|.:.:::::..||.|||:.:::..:|    .::.|||:    |..::|...:..|.
plant   127 QG------IVGLHRQVMKEHDEALDMLEETVMRVKHNALVMNEQIGL----QTRLIDGLDHHVDV 181

  Fly   295 TESKLDTTMKKVAKVLHM 312
            ::|.:        :|:|:
plant   182 SDSGV--------RVIHI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 0/3 (0%)
SNARE_Syntaxin6 250..315 CDD:277204 15/67 (22%)
AT1G16230NP_001319019.1 SNARE_Qc 137..187 CDD:277194 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.