DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and SYP72

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001319688.1 Gene:SYP72 / 823666 AraportID:AT3G45280 Length:267 Species:Arabidopsis thaliana


Alignment Length:291 Identity:64/291 - (21%)
Similarity:117/291 - (40%) Gaps:59/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RELGENGGTEAEWTTTELRNSLRSIEWDLEDL--EDTISIVEKNPSKFRIDNRELSSRRHFIDNT 107
            ||:|.:|........|       ||:.|:|.:  :..::..|||.:.....|.|:         .
plant    26 REIGASGDDAFSRLFT-------SIDSDIEAVLRKAELASTEKNRAAAVAMNAEV---------R 74

  Fly   108 RDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHSIAIPNSNSNSNEYHQHPHNDRTYLV 172
            |.:.:..:|.:.|.:...:.|..    |..:......:..||:.               ||  |.
plant    75 RTKARLAEDVVKLQKLAVKKIKG----LTREERESRCDLVIALA---------------DR--LQ 118

  Fly   173 ECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSKLENALDSPSHYGQTHHGGMDSPSHR 237
            ..|:||   ..|::.||:..|      .|::.:...|:...|..:|. ..:.|:.    :|...|
plant   119 AIPDGN---EHGAKQANSDWG------GASAPNKNIKFDMSEEDMDD-GFFQQSE----ESSQFR 169

  Fly   238 YVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTT 302
            ...|    .:|  :.|||.||:||:.:..||.::|.:..|||:|..::::...:.|...|.|..|
plant   170 QEYE----MRR--KKQDEGLDIISEGLDALKNLARDMNEELDKQVPLMEEMETKVDGATSDLKNT 228

  Fly   303 MKKVAKVLHMNNDKRQWAAILILSGLLLFVI 333
            ..::.|.|......|.:...:||..::|.::
plant   229 NVRLKKQLVQMRSSRNFCIDIILLCVILGIV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 15/71 (21%)
SNARE_Syntaxin6 250..315 CDD:277204 20/64 (31%)
SYP72NP_001319688.1 SNARE_Qc 176..234 CDD:277194 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.