DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and stx6

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001039240.1 Gene:stx6 / 734102 XenbaseID:XB-GENE-1015934 Length:254 Species:Xenopus tropicalis


Alignment Length:322 Identity:123/322 - (38%)
Similarity:170/322 - (52%) Gaps:79/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PF--PNSEVFKALNKTRGLYLRWRELGENGG----TEAEWTTTELRNSLRSIEWDLEDLEDTISI 82
            ||  ...||.||:|..:||:.||.:|.::..    .|.:|||.||||:|||||||||||::||||
 Frog     6 PFFVVRGEVQKAVNTAQGLFQRWTDLLQDPSISTREELDWTTNELRNNLRSIEWDLEDLDETISI 70

  Fly    83 VEKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHS 147
            ||.||.||.:|..||..|:.||..||..||.|||:|:                     ||:..  
 Frog    71 VESNPRKFSLDPAELRQRKAFISETRQCVKDMKDRMT---------------------SPSVQ-- 112

  Fly   148 IAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSK 212
                                  .|.|..|..:|:..|                  ::|.....::
 Frog   113 ----------------------ALTEKKNRQALLGEG------------------TKHGWNLETE 137

  Fly   213 LENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVE 277
            ...|||..          :::.:.:::...|..||.:::.|||||:::|.|||.||.:|::||.|
 Frog   138 KYKALDQE----------LENANSQFLDGQVGQQQLIMEQQDEQLELVSGSIGVLKNMSQRIGSE 192

  Fly   278 LDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFIIL 339
            |||||||||||.:|.||.:|::|..:||:|||.||.:|:|||.||:||..|||.|:|||..|
 Frog   193 LDEQAVMLDDFSHELDTAQSRMDNVLKKLAKVSHMTSDRRQWCAIIILLSLLLVVLILFFAL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 49/89 (55%)
SNARE_Syntaxin6 250..315 CDD:277204 38/64 (59%)
stx6NP_001039240.1 Syntaxin-6_N 13..103 CDD:286286 49/89 (55%)
SNARE_Syntaxin6 165..230 CDD:277204 38/64 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6972
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H115622
Inparanoid 1 1.050 166 1.000 Inparanoid score I4050
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 1 1.000 - - FOG0003084
OrthoInspector 1 1.000 - - otm49465
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3993
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.