DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and Stx6

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_113853.1 Gene:Stx6 / 60562 RGDID:61915 Length:255 Species:Rattus norvegicus


Alignment Length:323 Identity:130/323 - (40%)
Similarity:177/323 - (54%) Gaps:80/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PF--PNSEVFKALNKTRGLYLRWREL--GENGGT--EAEWTTTELRNSLRSIEWDLEDLEDTISI 82
            ||  ...||.||:|..:||:.||.||  |.:..|  |.:|||.||||:|||||||||||::||||
  Rat     6 PFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLEDLDETISI 70

  Fly    83 VEKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHS 147
            ||.||.||.:|..|||.|:.||.:||..|:.|||:||.:     .:.|                 
  Rat    71 VEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQMSAS-----SVQA----------------- 113

  Fly   148 IAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLI-NSGSQVANTIAGTMSAAAAAASRHSGTKYS 211
                                   |.|..|..:|: :|.||  |..||...            :|.
  Rat   114 -----------------------LAERKNRQALLGDSSSQ--NWDAGVTD------------RYG 141

  Fly   212 KLENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGV 276
            :|:..|...:             || ::.|..:.||.:::.|||||:::|.|||.||.:|::||.
  Rat   142 RLDRELQLAN-------------SH-FIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGG 192

  Fly   277 ELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFIIL 339
            ||:|||||||||.:|.::|:|:||..|||:|||.||.:|:|||.||.||..:||.|:.||::|
  Rat   193 ELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLTLFLVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 52/89 (58%)
SNARE_Syntaxin6 250..315 CDD:277204 38/64 (59%)
Stx6NP_113853.1 Interaction with UHRF1BP1L. /evidence=ECO:0000269|PubMed:20163565 2..112 59/110 (54%)
SNARE_NTD_STX6 5..107 CDD:410573 57/100 (57%)
SNARE_Syntaxin6 166..231 CDD:277204 38/64 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347835
Domainoid 1 1.000 102 1.000 Domainoid score I6702
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115622
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53942
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 1 1.000 - - FOG0003084
OrthoInspector 1 1.000 - - oto98781
orthoMCL 1 0.900 - - OOG6_101619
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3993
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.720

Return to query results.
Submit another query.