DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and Stx8

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_038942648.1 Gene:Stx8 / 59074 RGDID:61917 Length:253 Species:Rattus norvegicus


Alignment Length:226 Identity:61/226 - (26%)
Similarity:86/226 - (38%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHSI 148
            ||.| |..:..|.|      :.|.:.::..:|| :.|.....|.||.    |:.||         
  Rat    59 EKTP-KLTLTIRTL------LKNLKVKIDLLKD-LLLRAVSTRQITQ----LEGDR--------- 102

  Fly   149 AIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSKL 213
                   ..|........:|..|.      |..|.||:.....:..||..|     ..||....|
  Rat   103 -------RQNLLDDLVTRERLLLA------SFKNEGSEPDLIRSSLMSEEA-----KRGTPNPWL 149

  Fly   214 ENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVEL 278
               .:.|.   :|...|.|        |....||::||.||..||.:|..|...|.:.::||.||
  Rat   150 ---CEEPE---ETRGLGFD--------EIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNEL 200

  Fly   279 DEQAVMLDDFGNEFDTTESKLDTTMKKVAKV 309
            |||..::||..|..:.|:.||.|..::|..|
  Rat   201 DEQNEIIDDLANLVENTDEKLRTEARRVTLV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 7/30 (23%)
SNARE_Syntaxin6 250..315 CDD:277204 25/60 (42%)
Stx8XP_038942648.1 SNARE_Syntaxin8 176..230 CDD:277205 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.