DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and Stx8

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_061238.1 Gene:Stx8 / 55943 MGIID:1890156 Length:236 Species:Mus musculus


Alignment Length:92 Identity:34/92 - (36%)
Similarity:53/92 - (57%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 QQRMIQGQDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVL 310
            ||::||.||..||.:|..|...|.:.::||.|||||..::||..|..:.|:.||.|..::|..| 
Mouse   144 QQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLV- 207

  Fly   311 HMNNDKRQWAAILILSGLLLFVIILFI 337
                |::..:..:|:..|||.|.|:.:
Mouse   208 ----DRKSTSCGMIMVILLLLVAIVVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286
SNARE_Syntaxin6 250..315 CDD:277204 25/64 (39%)
Stx8NP_061238.1 SNARE_Syntaxin8 152..206 CDD:277205 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.