DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and Stx8

DIOPT Version :10

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_061238.1 Gene:Stx8 / 55943 MGIID:1890156 Length:236 Species:Mus musculus


Alignment Length:92 Identity:34/92 - (36%)
Similarity:53/92 - (57%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 QQRMIQGQDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVL 310
            ||::||.||..||.:|..|...|.:.::||.|||||..::||..|..:.|:.||.|..::|..| 
Mouse   144 QQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLV- 207

  Fly   311 HMNNDKRQWAAILILSGLLLFVIILFI 337
                |::..:..:|:..|||.|.|:.:
Mouse   208 ----DRKSTSCGMIMVILLLLVAIVVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 SNARE_NTD_STX6_STX10 24..119 CDD:410569
SNARE_Syntaxin6 250..315 CDD:277204 25/64 (39%)
Stx8NP_061238.1 SNARE_Syntaxin8 152..206 CDD:277205 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.