DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and Syx4

DIOPT Version :10

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster


Alignment Length:170 Identity:36/170 - (21%)
Similarity:60/170 - (35%) Gaps:45/170 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LDNDRHSPNHNHSIAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLIN--SGSQ---VANTIAGT 194
            :..||.......|::..:|||:|                  ||:.|:|  ||:.   :.||....
  Fly     1 MGKDRLPELLQRSLSTNSSNSSS------------------NGSLLLNVYSGTTEFIIGNTGGNN 47

  Fly   195 MSAAAAAASRHSGTKYSKLENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDM 259
            .|.:..:.:.||.:..:......|..|.....:...:|...:.|    ..|:|::.|        
  Fly    48 NSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPY----TEIRQQLAQ-------- 100

  Fly   260 ISDSIGTLKTVSRQIGVELDEQAVMLDDFG-NEFDTTESK 298
               ....|:|::|.      .|.|.|..|. ||.|...:|
  Fly   101 ---IAANLETMNRM------AQTVNLRTFNENEMDELHNK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 SNARE_NTD_STX6_STX10 24..119 CDD:410569
SNARE_Syntaxin6 250..315 CDD:277204 12/50 (24%)
Syx4NP_525057.2 COG5074 <187..313 CDD:227406
SNARE_syntaxin1-like 238..298 CDD:277201
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.