DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and syx-6

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001379673.1 Gene:syx-6 / 259698 WormBaseID:WBGene00015789 Length:122 Species:Caenorhabditis elegans


Alignment Length:136 Identity:49/136 - (36%)
Similarity:85/136 - (62%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SGTKYSKL---ENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTL 267
            |..:||||   |.:|:             |.||.  ..:.::.|:::||.||::|:::.:|:.||
 Worm     2 SNYRYSKLNEEEISLE-------------DMPSS--ANQILTRQEQIIQEQDDELELVGNSVRTL 51

  Fly   268 KTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFV 332
            :.:|..||.|||:|:.||||.|.|.:.:|::|||.|||:||:.|:.::..|...|::||.||.|:
 Worm    52 RGMSSMIGDELDQQSTMLDDLGQEMEYSETRLDTAMKKMAKLTHLEDESSQCKMIMVLSALLFFL 116

  Fly   333 IILFII 338
            :.:.::
 Worm   117 VFVLLV 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286
SNARE_Syntaxin6 250..315 CDD:277204 31/64 (48%)
syx-6NP_001379673.1 SNARE_Syntaxin6 34..99 CDD:277204 31/64 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166569
Domainoid 1 1.000 55 1.000 Domainoid score I7448
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 1 1.000 - - FOG0003084
OrthoInspector 1 1.000 - - oto19928
orthoMCL 1 0.900 - - OOG6_101619
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1528
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.