DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and SPCC594.06c

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_587792.1 Gene:SPCC594.06c / 2538847 PomBaseID:SPCC594.06c Length:341 Species:Schizosaccharomyces pombe


Alignment Length:319 Identity:66/319 - (20%)
Similarity:116/319 - (36%) Gaps:83/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KCYLTYISVFSFISLPFPNSEVFKALN-------KTRGLYLRWRELGENGGTEAEWTTTELRNSL 66
            :.|:..:|...:|.:|.    |.|.||       :|:|.:|        |.|:......:.:.:|
pombe    87 QAYVQCLSETPWIKMPV----VKKFLNIKDESEDETQGQFL--------GPTDWIQVFQDCKRNL 139

  Fly    67 RSIEWDLEDLED-TISIVEKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSL-NRSRDRDIT 129
            .....||...:. ||.:..||.              :.|.:..|.:.:..||:.| |.....:|.
pombe   140 HMYRVDLMSGKSITIGVQTKNV--------------YAIKSLMDNLSESLDKLELANALGPGEIL 190

  Fly   130 AHQPLLDN--------DRHSPNHNHSIAIPNSNSNSNEYH-QHPHNDRTYLVECPNGNSLINSGS 185
            ..:.:|:.        .|...|.|..:|.|:::|..|..: ..|....:...:..:..||     
pombe   191 RRKDMLEQLGSEFLSFKRLVKNANSPVAPPSASSQLNSSNPSSPFRPLSASTDKQSNTSL----- 250

  Fly   186 QVANTIAGTMSAAAAAASRHSGTKYSKLENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMI 250
               |.:.|        .:|...|:.:|   .||:...|                    ::|.:.:
pombe   251 ---NRVLG--------KNRMPETQTTK---KLDNVGLY--------------------NMQNQTM 281

  Fly   251 QGQDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKV 309
            :.||.|.:.:...|...|.:|:.|..|:.||..|||:..||....:.||..|...:.|:
pombe   282 EDQDMQAESLLPIIQRQKELSKMINQEVVEQNSMLDELSNEAYANQKKLHRTRAGLRKL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 18/93 (19%)
SNARE_Syntaxin6 250..315 CDD:277204 19/60 (32%)
SPCC594.06cNP_587792.1 PX_SNARE 3..111 CDD:132807 8/27 (30%)
SNARE_VAM7 281..339 CDD:277211 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.