DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and pfut-1

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_741744.2 Gene:pfut-1 / 180607 WormBaseID:WBGene00015793 Length:389 Species:Caenorhabditis elegans


Alignment Length:30 Identity:10/30 - (33%)
Similarity:14/30 - (46%) Gaps:4/30 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISVFSFISLPFPNSEVFKALNKTRGLYLRW 44
            :..||....|||:.....::.|    ||||
 Worm   189 VLAFSSAPAPFPSKGKVWSIQK----YLRW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 5/16 (31%)
SNARE_Syntaxin6 250..315 CDD:277204
pfut-1NP_741744.2 O-FucT-1 27..381 CDD:211388 10/30 (33%)
O-FucT 37..374 CDD:287252 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.