DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx6 and LOC110440104

DIOPT Version :9

Sequence 1:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_021335540.1 Gene:LOC110440104 / 110440104 -ID:- Length:247 Species:Danio rerio


Alignment Length:322 Identity:114/322 - (35%)
Similarity:161/322 - (50%) Gaps:86/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PF--PNSEVFKALNKTRGLYLRWRELGEN----GGTEAEWTTTELRNSLRSIEWDLEDLEDTISI 82
            ||  ...||.|||:|.:|||.||.||.:.    ...|.:|:|.||||.||:|:||||||.:||||
Zfish     6 PFFVVKGEVQKALSKAQGLYERWEELLQEETPVSRDELDWSTNELRNCLRAIDWDLEDLHETISI 70

  Fly    83 VEKNPSKFRIDNRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHS 147
            ||.||.|||:...||..||.|::.||..|:.||:::|                     ||:    
Zfish    71 VEANPGKFRLGEHELQERRDFVERTRKSVQLMKEQLS---------------------SPS---- 110

  Fly   148 IAIPNSNSNSNEYHQHPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSK 212
             |:..:                   |..|..:|:                .|.|..|::|.    
Zfish   111 -AVAQA-------------------EKKNKQALL----------------GATAKDRYAGL---- 135

  Fly   213 LENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQIGVE 277
                        :.|   :.|.:.||:.|....||.::|.|||.|::::.||..||.:|.:||.|
Zfish   136 ------------EPH---LVSANSRYIQEQQEQQQLIMQDQDEHLELVTGSIRVLKDMSSRIGDE 185

  Fly   278 LDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFIIL 339
            ||||||||.:|..|.|.|.|::|:.:||:.||.||.:.:|||.||.:|..:|:.|:|||..:
Zfish   186 LDEQAVMLGEFNEEMDQTGSRMDSVLKKMEKVSHMTSSRRQWCAIGVLVIILIVVLILFFAI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 48/89 (54%)
SNARE_Syntaxin6 250..315 CDD:277204 33/64 (52%)
LOC110440104XP_021335540.1 Syntaxin-6_N 13..103 CDD:312631 48/89 (54%)
SNARE_Syntaxin6 158..222 CDD:277204 33/63 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.