DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp1 and ALPG

DIOPT Version :10

Sequence 1:NP_001262159.1 Gene:Alp1 / 40372 FlyBaseID:FBgn0283479 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_112603.2 Gene:ALPG / 251 HGNCID:441 Length:532 Species:Homo sapiens


Alignment Length:77 Identity:18/77 - (23%)
Similarity:35/77 - (45%) Gaps:13/77 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSLSSVLASSKLHGNSAH---EMVSILNQNRTARKLGKL--NESPGL------GCMALQYVE--L 66
            |.|.:|.|.::||....:   ..:|:::...:...:.:|  |.:||:      ||:|..|..  |
Human    44 LILITVCADTQLHARPMYIFLGALSVIDMGISTIIVPRLMMNFTPGIKPIPFGGCVAQLYFYHFL 108

  Fly    67 CEGNCNVNNTLS 78
            ....|.:..|::
Human   109 GSSQCFLYTTMA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alp1NP_001262159.1 alkPPc 65..514 CDD:214515 3/16 (19%)
ALPGNP_112603.2 Alk_phosphatase 52..487 CDD:395188 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.