DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Aef1 and AT3G29340

DIOPT Version :9

Sequence 1:	NP_001262157.1	Gene:	Aef1 / 40370	FlyBaseID:	FBgn0005694	Length:	454	Species:	Drosophila melanogaster
Sequence 2:	NP_189580.1	Gene:	AT3G29340 / 822592	AraportID:	AT3G29340	Length:	650	Species:	Arabidopsis thaliana

Alignment Length:	192	Identity:	40/192 - (20%)
Similarity:	55/192 - (28%)	Gaps:	71/192 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   186 CTVCDRRFRQLSTLTNHVKIH---------------------------TGEKPYKCNVCDKTFRQ 223
            |.:|.:.|.....|..|.:||                           :....|:|.||.|.|..
plant    45 CKICGKSFECYQALGGHQRIHRPIKEKLSKQEFSEVYPRKSKLQKRPESSSSCYECKVCGKIFGC 109

  Fly   224 SSTLTNHLKIHTG-----------------------------------EKPYNCNFCPKHFRQ-- 251
            ...|..|.|:|..                                   ||..:|....:.|.:
plant   110 YRGLGGHTKLHRSTKRELASTQDENSLLDSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPL 174

  Fly   252 ------LSTLANHVKIHTGEK-PFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEED 306
                  .|||.:.::..|..| ...|.||.|.|..|..|.||.::|......:..|.|..||
plant   175 SHSGALPSTLRSKLQTKTQWKSSCHCKICGKSFVCSQGLGNHKRVHREISGKLACKRKYTED 236

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Aef1	NP_001262157.1	C2H2 Zn finger	186..206	CDD:275368	5/19 (26%)
		zf-H2C2_2	199..223	CDD:290200	10/50 (20%)
		C2H2 Zn finger	214..234	CDD:275368	8/19 (42%)
		zf-H2C2_2	227..251	CDD:290200	8/58 (14%)
		C2H2 Zn finger	242..262	CDD:275368	5/27 (19%)
		zf-H2C2_2	255..279	CDD:290200	8/24 (33%)
		C2H2 Zn finger	270..290	CDD:275368	9/19 (47%)
AT3G29340	NP_189580.1	zf-C2H2_6	43..68	CDD:290623	7/22 (32%)
		C2H2 Zn finger	45..65	CDD:275368	5/19 (26%)
		C2H2 Zn finger	100..120	CDD:275368	8/19 (42%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	42	1.000	Inparanoid score	I2696
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050