DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Aef1 and ZNF32

DIOPT Version :9

Sequence 1:	NP_001262157.1	Gene:	Aef1 / 40370	FlyBaseID:	FBgn0005694	Length:	454	Species:	Drosophila melanogaster
Sequence 2:	NP_001311093.1	Gene:	ZNF32 / 7580	HGNCID:	13095	Length:	277	Species:	Homo sapiens

Alignment Length:	116	Identity:	54/116 - (46%)
Similarity:	75/116 - (64%)	Gaps:	0/116 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 EKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFC 245
            ::.:.|..|.:.|||..:||.|.:||||:||::|..|.|:||....|..|.:||||||||.|..|
Human    78 QRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKEC 142

  Fly   246 PKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVY 296
            .|.|.|..:||.|.::|||:||:||.||::.||..|.|..|.::|..:|.|
Human   143 GKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPY 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Aef1	NP_001262157.1	C2H2 Zn finger	186..206	CDD:275368	8/19 (42%)
		zf-H2C2_2	199..223	CDD:290200	13/23 (57%)
		C2H2 Zn finger	214..234	CDD:275368	7/19 (37%)
		zf-H2C2_2	227..251	CDD:290200	14/23 (61%)
		C2H2 Zn finger	242..262	CDD:275368	8/19 (42%)
		zf-H2C2_2	255..279	CDD:290200	13/23 (57%)
		C2H2 Zn finger	270..290	CDD:275368	8/19 (42%)
ZNF32	NP_001311093.1	COG5048	<51..241	CDD:227381	54/116 (47%)
		C2H2 Zn finger	83..103	CDD:275368	8/19 (42%)
		C2H2 Zn finger	111..131	CDD:275368	7/19 (37%)
		C2H2 Zn finger	139..159	CDD:275368	8/19 (42%)
		C2H2 Zn finger	167..187	CDD:275368	8/19 (42%)
		C2H2 Zn finger	195..215	CDD:275368
		C2H2 Zn finger	223..243	CDD:275368
		C2H2 Zn finger	251..269	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S2583
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950