DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and sens

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:305 Identity:89/305 - (29%)
Similarity:121/305 - (39%) Gaps:68/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKSLPHAHAAATAMSSNC--DIVIVAAQPQTTI--------ANNNNNETVTQATHPAHMAAVQQQ 58
            |.||....::.:|.:||.  |:....||.|...        ...||.|.:||     |:....:|
  Fly   257 ISSLQSPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNNLELLTQ-----HLKLKSEQ 316

  Fly    59 QQQQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQ 123
            .||||||.:...:|||...|                                |||:....|||..
  Fly   317 PQQQQQQHRIKDEQQQDNRS--------------------------------AAALMNLVAAAEF 349

  Fly   124 AAAAEQQQPP------------PPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGNAAVGVGGA 176
            .....|.|.|            .|..| .|...|..:|.......::..|.:.||...       
  Fly   350 GYMRNQHQQPQQQQQQQLHHQQQPQQH-QHQQQHPDSTATDVARRSSSSSSYQGENEE------- 406

  Fly   177 VREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYN 241
             :...:.|.|..|.:.|::.|||:.|:.||:..:||.|..|.|.|.|.|.:..|..|||||||:.
  Fly   407 -KRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHK 470

  Fly   242 CNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNH 286
            |..|.|.|.|.|.|..|::.|||.|||.|.:|.:.|::...|..|
  Fly   471 CTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRH 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 7/19 (37%)
zf-H2C2_2 199..223 CDD:290200 10/23 (43%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..251 CDD:290200 12/23 (52%)
C2H2 Zn finger 242..262 CDD:275368 8/19 (42%)
zf-H2C2_2 255..279 CDD:290200 11/23 (48%)
C2H2 Zn finger 270..290 CDD:275368 5/17 (29%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 8/21 (38%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
COG5048 423..>497 CDD:227381 34/73 (47%)
zf-H2C2_2 428..452 CDD:290200 10/23 (43%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 455..480 CDD:290200 12/24 (50%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..516 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I4014
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.