DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and gl

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster


Alignment Length:460 Identity:113/460 - (24%)
Similarity:171/460 - (37%) Gaps:170/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QTTIANNNNNETVTQATHPAHMAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSV------------ 83
            |..|:.|::|.....:.|       ||.|.||.|.|..|......||||..::            
  Fly   193 QMLISPNSHNHGQMHSQH-------QQHQHQQSQVQASHVGNSLLQSSGGNNIGSNGSAGGVANA 250

  Fly    84 --------------PPPPTELPLP---------FQMH-------LSGISAE---------AHSAA 109
                          ||||.....|         ..||       ..|:..:         ::|.:
  Fly   251 ASCYYETSAGTAAPPPPPAAAMYPSMSVNVSMNMTMHHGYGAGDAGGVPMQCSQMNWTPPSNSTS 315

  Fly   110 QAAAMAAAQ-------------AAAAQAAAA-------------------EQQQPPPPTSHLTHL 142
            .|||.||..             |:|..:..|                   |::.|.||.:  :.|
  Fly   316 AAAAAAAVNVLYPPLLSPGHYPASATYSFTADFRAPAPTGLGALPPLTVGEKESPSPPAN--SSL 378

  Fly   143 TTHSPTTIHSEHYLANGHSEHPGEGNAAVGV----------------------GGAVR------- 178
            ..:.||.:.::.| ...|........||:|:                      ||.::       
  Fly   379 AGYYPTGVGNQGY-TPPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGSSGGEMKPNLCRLC 442

  Fly   179 -----------------EPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSST 226
                             ..|:|:.|..|::.|.|.:.||.||:.|||:||::|.:||:.|.|||:
  Fly   443 GKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSS 507

  Fly   227 LTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHV 291
            :|.|::.|:||:||.|:.|.|.|...|||..|::||:||||::|.:|..:|.||..||.|:::|.
  Fly   508 VTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHG 572

  Fly   292 MDKVYVPVKIKTEEDEGXLG--------------------RMPLAA----HHHQQQQHQHHHQQQ 332
            .:.       .:....| .|                    :.|.:|    |:|....|..|||..
  Fly   573 NNN-------SSNGSNGATGVGGESSTGSGVGGGNSLLTXQKPRSAGGFQHYHPPHTHHMHHQHH 630

  Fly   333 QHQHH 337
            .|.||
  Fly   631 AHHHH 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 8/19 (42%)
zf-H2C2_2 199..223 CDD:290200 13/23 (57%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)
zf-H2C2_2 227..251 CDD:290200 11/23 (48%)
C2H2 Zn finger 242..262 CDD:275368 8/19 (42%)
zf-H2C2_2 255..279 CDD:290200 11/23 (48%)
C2H2 Zn finger 270..290 CDD:275368 8/19 (42%)
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 0/19 (0%)
zf-C2H2 439..459 CDD:278523 0/19 (0%)
zf-H2C2_2 452..476 CDD:290200 5/23 (22%)
C2H2 Zn finger 467..487 CDD:275368 8/19 (42%)
zf-H2C2_2 479..504 CDD:290200 13/24 (54%)
zf-C2H2_8 492..570 CDD:292531 37/77 (48%)
C2H2 Zn finger 495..515 CDD:275368 9/19 (47%)
zf-H2C2_2 507..531 CDD:290200 10/23 (43%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 536..560 CDD:290200 11/23 (48%)
C2H2 Zn finger 551..571 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BIHU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.