Sequence 1: | NP_001262157.1 | Gene: | Aef1 / 40370 | FlyBaseID: | FBgn0005694 | Length: | 454 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262708.1 | Gene: | gl / 42210 | FlyBaseID: | FBgn0004618 | Length: | 679 | Species: | Drosophila melanogaster |
Alignment Length: | 460 | Identity: | 113/460 - (24%) |
---|---|---|---|
Similarity: | 171/460 - (37%) | Gaps: | 170/460 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 QTTIANNNNNETVTQATHPAHMAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSV------------ 83
Fly 84 --------------PPPPTELPLP---------FQMH-------LSGISAE---------AHSAA 109
Fly 110 QAAAMAAAQ-------------AAAAQAAAA-------------------EQQQPPPPTSHLTHL 142
Fly 143 TTHSPTTIHSEHYLANGHSEHPGEGNAAVGV----------------------GGAVR------- 178
Fly 179 -----------------EPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSST 226
Fly 227 LTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHV 291
Fly 292 MDKVYVPVKIKTEEDEGXLG--------------------RMPLAA----HHHQQQQHQHHHQQQ 332
Fly 333 QHQHH 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Aef1 | NP_001262157.1 | C2H2 Zn finger | 186..206 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 199..223 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 227..251 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 242..262 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 255..279 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 270..290 | CDD:275368 | 8/19 (42%) | ||
gl | NP_001262708.1 | C2H2 Zn finger | 439..459 | CDD:275368 | 0/19 (0%) |
zf-C2H2 | 439..459 | CDD:278523 | 0/19 (0%) | ||
zf-H2C2_2 | 452..476 | CDD:290200 | 5/23 (22%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 479..504 | CDD:290200 | 13/24 (54%) | ||
zf-C2H2_8 | 492..570 | CDD:292531 | 37/77 (48%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 507..531 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 523..543 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 536..560 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 551..571 | CDD:275368 | 8/19 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BIHU | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |