DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and hkb

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:108/275 - (39%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKSLPHAHAAATAMSS-----NCDIVIVAAQPQTTIANNN---------NNETVTQATHPAHMAA 54
            :|..|.|....|.::|     :||....:|....:.::|:         |:.:.|:.:.|...||
  Fly    34 VKQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAA 98

  Fly    55 VQQQQQQQQQQQQQHHQQQQQQSSGPPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQA 119
            ........|......|      ::...|:.||....|.     ||..|...::||.|||.||:..
  Fly    99 PHPVFSHPQSSPLDTH------AAATASLAPPNQHAPF-----LSAASDLYYAAAAAAAAAASTP 152

  Fly   120 AAAQAAAAEQQQPPPPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPF 184
            .|......:     |.|..|............::....|...:.|                 |.|
  Fly   153 TAVPGFGMD-----PFTMGLMEQEYARVMAEDAQLKALNSRKQRP-----------------KKF 195

  Fly   185 HCTVCDRRFRQLSTLTNHVKIHTGEKPYKC--NVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPK 247
            .|..||..|.....|..|::|||||:|:||  |.|.|||.::..||.|.:||||.:||.|:.|.|
  Fly   196 KCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGK 260

  Fly   248 HFRQLSTLANHVKIH 262
            .|.:...|..|:|.|
  Fly   261 KFGRRDHLKKHMKTH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 6/19 (32%)
zf-H2C2_2 199..223 CDD:290200 15/25 (60%)
C2H2 Zn finger 214..234 CDD:275368 9/21 (43%)
zf-H2C2_2 227..251 CDD:290200 13/23 (57%)
C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
zf-H2C2_2 255..279 CDD:290200 4/8 (50%)
C2H2 Zn finger 270..290 CDD:275368
hkbNP_524221.1 COG5048 195..>261 CDD:227381 31/65 (48%)
zf-C2H2 195..217 CDD:278523 7/21 (33%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 15/25 (60%)
C2H2 Zn finger 225..247 CDD:275368 9/21 (43%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.