DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and sna

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:315 Identity:79/315 - (25%)
Similarity:118/315 - (37%) Gaps:65/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MHIKSLPHAHAAATAMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPAHMAAVQQQQQQQQQQQ 66
            :|::.|.   |..|..::.....|...|....:|...|..:...:::..|:||...........|
  Fly   101 IHMRGLT---AGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAAFPSPASSMASPQ 162

  Fly    67 QQHHQQQQQQSSGPPSVPPPPTE-------------LPLPFQMHL--------SGISAEAHS--- 107
            ..:..||..    |||.|....|             :|||...||        ||.|..:.|   
  Fly   163 SVYSYQQMT----PPSSPGSDLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYS 223

  Fly   108 -----AAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLT-HLTTHSPTTIHSEHYLANGHSEHPGE 166
                 :|.:|::||..|...:....|.|:....:..|: |...|.|.                .|
  Fly   224 YTPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPA----------------AE 272

  Fly   167 GNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHL 231
            .|          :.:|...|..|.:.:..:..|..|::.||  .|.||.:|.|.|.:...|..|:
  Fly   273 CN----------QEKKTHSCEECGKLYTTIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHI 325

  Fly   232 KIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNH 286
            :.||||||:.|..||:.|...|.|..|.:.|...|.:.|.:|.|.|.:.|.||.|
  Fly   326 RTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 4/19 (21%)
zf-H2C2_2 199..223 CDD:290200 10/23 (43%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
zf-H2C2_2 227..251 CDD:290200 12/23 (52%)
C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
zf-H2C2_2 255..279 CDD:290200 8/23 (35%)
C2H2 Zn finger 270..290 CDD:275368 8/17 (47%)
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 321..344 CDD:290200 11/22 (50%)
zf-C2H2 334..356 CDD:278523 7/21 (33%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 8/24 (33%)
C2H2 Zn finger 364..380 CDD:275368 7/15 (47%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
zf-C2H2 306..328 CDD:278523 7/21 (33%)
COG5048 307..>356 CDD:227381 20/48 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.