DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and Cf2

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:314 Identity:91/314 - (28%)
Similarity:128/314 - (40%) Gaps:75/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AMSSNCDIVIVAAQPQTTIANNNNNETVTQATHPAHMAAVQQQQQQQQ----------------Q 64
            |::.:..:..:|.:.........:::...||.|.......||||||||                |
  Fly   203 AVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQ 267

  Fly    65 QQQQHHQQQQQQSSGPP---SVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQAAA 126
            |||.||.||.|..:|..   .|||               ::.:.:..|...|:            
  Fly   268 QQQVHHHQQDQDLAGDQVALKVPP---------------LTVKLNKNANGGAI------------ 305

  Fly   127 AEQQQPPPPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGN------AAVGV-GGAVREPEKPF 184
                     .||...:....|.::.....:.|....:..:.|      |:.|| .|....|....
  Fly   306 ---------VSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLA 361

  Fly   185 H-----CTVCDRRFRQLSTLTNHVKIHTG-------EKPYKCNVCDKTFRQSSTLTNHLKIHTGE 237
            |     |..|.:.|:...||..|.|||||       |:||.|:.|.|:|.||:||..|.:|||||
  Fly   362 HKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGE 426

  Fly   238 KPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNH-IKIH 290
            ||::|.:|.|.|.....|..|::.||||||:.|..|.|:|.|.|.|..| .|:|
  Fly   427 KPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 7/19 (37%)
zf-H2C2_2 199..223 CDD:290200 14/30 (47%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)
zf-H2C2_2 227..251 CDD:290200 13/23 (57%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 255..279 CDD:290200 12/23 (52%)
C2H2 Zn finger 270..290 CDD:275368 9/20 (45%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 48/106 (45%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.