DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and odd

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:367 Identity:110/367 - (29%)
Similarity:151/367 - (41%) Gaps:82/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DIVIVAAQPQTTIA-----NNNNNETVTQATHPA-------------HMAAVQQQQQQQQQQQQQ 68
            |.:::..:.:|:::     .:...|...:..|||             |||..||||||||||||.
  Fly    30 DFIVIKEERETSLSPMLTPPHTPTEEPLRRVHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQH 94

  Fly    69 ----HHQQQQQQSSGPPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQAAAAEQ 129
                ..||||||...|...|..||....|..:|...::....:||              ....:|
  Fly    95 RLWLQMQQQQQQHQAPQQYPVYPTASADPVAVHQQLMNHWIRNAA--------------IYQQQQ 145

  Fly   130 QQPPPPTSHLTHLTTHSPTTIHSEH---YLANGHSEHPGEGNAAV--------------GVGGA- 176
            ||...|..|..|...|.|.. |..|   |.|..||.|     |||              |.||| 
  Fly   146 QQQQHPHHHHHHGHPHHPHP-HPHHVRPYPAGLHSLH-----AAVMGRHFGAMPTLKLGGAGGAS 204

  Fly   177 --------VREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKI 233
                    ...|:|.|.|..|:|:|.:...|..|.:.||.|:||.|::|.|.||:...|.:|..|
  Fly   205 GVPSGATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYI 269

  Fly   234 HTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVP 298
            |:.:||:.|:.|.|.|.|..|||.|...|..|.|.:|.||::.|.|.:.|.:|::.|        
  Fly   270 HSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSH-------- 326

  Fly   299 VKIKTEED--EGXLGRMPLAAHHHQQQQHQHHHQQQQHQHHP 338
                :|:.  |. :...|..:|....|.......:...||.|
  Fly   327 ----SEQSTKEVVVTTSPATSHSVPNQALSSPQPENLAQHLP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 6/19 (32%)
zf-H2C2_2 199..223 CDD:290200 11/23 (48%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..251 CDD:290200 10/23 (43%)
C2H2 Zn finger 242..262 CDD:275368 9/19 (47%)
zf-H2C2_2 255..279 CDD:290200 10/23 (43%)
C2H2 Zn finger 270..290 CDD:275368 7/19 (37%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 47/142 (33%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
zf-H2C2_2 234..259 CDD:290200 11/24 (46%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 9/19 (47%)
zf-C2H2 304..326 CDD:278523 7/21 (33%)
C2H2 Zn finger 306..326 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.