DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and CG10959

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:306 Identity:73/306 - (23%)
Similarity:114/306 - (37%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NNETVTQATHPAH---------------MAAVQQQQQQQQQQQQQHHQQQQQQSSGPPSVPPPPT 88
            :.||:.....|.|               :..|:..|..|..:..:.||...::...|.....|..
  Fly   142 DEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHC 206

  Fly    89 ELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTIHSE 153
            :.....|.:|:.....:|...||......:|                             |...:
  Fly   207 DRRYTTQKYLNTHLKMSHPFPQAFKCVDCKA-----------------------------TFDVD 242

  Fly   154 HYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKC--NV 216
            ..||    :|.             |:....|.|.:||:.|:...:|..||:.|:|.:.:||  ..
  Fly   243 RALA----QHR-------------RKEHTEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHEN 290

  Fly   217 CDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSS 281
            |.|:|.....||:|.::|:.|:.|.|..|....|....|..|.:.|||||||:|..|.::|...|
  Fly   291 CGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKS 355

  Fly   282 TLNNHIKIHVMDKVYVPVKIKTEEDEGXLGRMPLAAHHHQQQQHQH 327
            .||.|..:|..:|.|     |.::.:....| |.|.:||   :|.|
  Fly   356 LLNEHQAMHSTEKPY-----KCDKCDSAFSR-PKALYHH---KHLH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 7/19 (37%)
zf-H2C2_2 199..223 CDD:290200 10/25 (40%)
C2H2 Zn finger 214..234 CDD:275368 7/21 (33%)
zf-H2C2_2 227..251 CDD:290200 8/23 (35%)
C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
zf-H2C2_2 255..279 CDD:290200 12/23 (52%)
C2H2 Zn finger 270..290 CDD:275368 7/19 (37%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/66 (9%)
COG5048 <258..416 CDD:227381 50/144 (35%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 316..336 CDD:275368 5/19 (26%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
zf-H2C2_2 357..381 CDD:290200 7/28 (25%)
C2H2 Zn finger 372..392 CDD:275368 6/23 (26%)
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.