DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and Opbp

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:380 Identity:89/380 - (23%)
Similarity:148/380 - (38%) Gaps:102/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HHQQQQQQSSG-PPSVPPPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQP 132
            |.|..||:||. ..|:.....|..:.:|||     .:.|...:.   :.:....||..:.::::|
  Fly   241 HKQMHQQESSEIMCSICNRKFENEVTYQMH-----QKIHEKPRD---SESSRKLAQRTSLDKEKP 297

  Fly   133 PPPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLS 197
            ..|..:...:.|.....:..|..       |.|               |||:.|.||.:.||...
  Fly   298 GFPCQYCERVFTRPFEKVKHERV-------HTG---------------EKPYACEVCGKTFRVSY 340

  Fly   198 TLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIH 262
            :||.|::.||..:||.|.||:|.|:.....::||:||:.|:.::|:.|||.||....|..|...|
  Fly   341 SLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTH 405

  Fly   263 TGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEDEGXLG----RMPLAAHHHQQQ 323
            |  ||:.|.:|.:.|.....:.||::.|           |....:| :|    .:..||....|.
  Fly   406 T--KPYRCAVCNRPFSSMYAVKNHMQTH-----------KEISSKGSVGSGTPNIKSAATSKSQA 457

  Fly   324 QHQHH----------------HQQQQHQHHPPPPSQQQQQHIDQRGVTITTLPSATTVAQHHQQH 372
            ..:.:                |.:..|      ...::|::           |:.:|.|.|    
  Fly   458 AGKFYCNTCGAEYARLFALRLHMKSAH------GLVEEQEN-----------PATSTDAAH---- 501

  Fly   373 QHIQDGSPHHHFNVAALGDLSSAMQLGAVTADGSFV--TMGGV-VVGRIQHTREE 424
                         ||...|..:|:.:.|..||.:::  .:..| :||.:. |.||
  Fly   502 -------------VAETDDSETAVLIAAAEADAAYINAVVNDVDIVGTVP-TYEE 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 8/19 (42%)
zf-H2C2_2 199..223 CDD:290200 12/23 (52%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..251 CDD:290200 10/23 (43%)
C2H2 Zn finger 242..262 CDD:275368 8/19 (42%)
zf-H2C2_2 255..279 CDD:290200 9/23 (39%)
C2H2 Zn finger 270..290 CDD:275368 5/19 (26%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/24 (21%)
C2H2 Zn finger 301..321 CDD:275368 2/26 (8%)
zf-H2C2_2 316..336 CDD:290200 9/41 (22%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.