DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and Zfp637

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001333576.1 Gene:Zfp637 / 232337 MGIID:2448537 Length:286 Species:Mus musculus


Alignment Length:279 Identity:81/279 - (29%)
Similarity:118/279 - (42%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 FQMHLSGISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTIHSEHYLAN 158
            |.:.|..:..|||....:.|..::......:...|:.:...|.|...                  
Mouse    32 FPLVLPDVMTEAHKYDPSEATGSSSWDFQSSFRREKLEQKSPESKAL------------------ 78

  Fly   159 GHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQ 223
             ..:.||           ||  :|.:.|..|.:.|||..:||.|.:||||:||::|..|.|:||.
Mouse    79 -QEDSPG-----------VR--QKVYDCQECGKSFRQKGSLTLHERIHTGQKPFECTQCGKSFRA 129

  Fly   224 SSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIK 288
            ...|..|.:||||||||.|..|.|.|.|..:||.|.::|||:||:||.||::.||..|.|..|.:
Mouse   130 KGNLVTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRR 194

  Fly   289 IHVMDKVY----------------VPVKIKTEEDEGXLGRMPLAAHHHQQQQHQHHH---QQQQH 334
            :|..:|.|                |.:::.|       |..|.|..|.::..|...:   ..:.|
Mouse   195 VHSGEKPYRCDQCGKAFSQKGSLIVHIRVHT-------GLKPYACSHCRKSFHTRGNCLLHGKVH 252

  Fly   335 QHHPPPPSQQQQQHIDQRG 353
            ....|....|..:...|||
Mouse   253 TGETPYLCGQCGKSFTQRG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 8/19 (42%)
zf-H2C2_2 199..223 CDD:290200 13/23 (57%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..251 CDD:290200 14/23 (61%)
C2H2 Zn finger 242..262 CDD:275368 8/19 (42%)
zf-H2C2_2 255..279 CDD:290200 13/23 (57%)
C2H2 Zn finger 270..290 CDD:275368 8/19 (42%)
Zfp637NP_001333576.1 COG5048 <60..251 CDD:227381 69/229 (30%)
C2H2 Zn finger 92..112 CDD:275368 8/19 (42%)
C2H2 Zn finger 120..140 CDD:275368 7/19 (37%)
C2H2 Zn finger 148..168 CDD:275368 8/19 (42%)
C2H2 Zn finger 176..196 CDD:275368 8/19 (42%)
C2H2 Zn finger 204..224 CDD:275368 1/19 (5%)
C2H2 Zn finger 232..252 CDD:275368 2/19 (11%)
C2H2 Zn finger 260..278 CDD:275368 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2583
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.