DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and B0310.2

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_508109.1 Gene:B0310.2 / 180403 WormBaseID:WBGene00015138 Length:413 Species:Caenorhabditis elegans


Alignment Length:261 Identity:58/261 - (22%)
Similarity:89/261 - (34%) Gaps:78/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QQQQQQQQQQQQQHHQQQQQQSSGPPSVP--PPPTELPLPFQMHLSGISAEAHSAAQAAAMAAAQ 118
            :::.::..:...|...::...|..|||:|  .|...:|:||          :::|.....:....
 Worm   144 RKRAKRSLEDTVQMLSKENSVSPPPPSLPFVLPQIPVPIPF----------SNAALMQRWLGHPL 198

  Fly   119 AAAAQAAAAEQQQPPPPTSH-----LTHLTTHS-------PTTIHSEHYL--------------- 156
            ...|...|..|.||.|..|.     |..:|.|:       |....|.|:.               
 Worm   199 TNPAYLNAMFQHQPAPKPSEEQFAALMKITMHAANFMKTVPQLPVSNHFTESDAEDIKIDVESDE 263

  Fly   157 ------------------ANGHSEHP------GEGNAAVGVGGAVREPEKPFHC--TVCDRRFRQ 195
                              ::..|..|      |:|:.|:         ||||.|  ..|.:||..
 Worm   264 GEIEVSPSPSTGDITENESSSSSTGPMISPNCGDGDCAL---------EKPFICMHNNCGKRFAN 319

  Fly   196 LSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKH----FRQLSTLA 256
            ...|..|:.||||.:|:.|..|.|.|.:...|..|.|.|:....:.....||:    ..||..|.
 Worm   320 KFLLKKHMFIHTGLRPHTCPHCHKKFNRKDNLLRHKKTHSPTSAHLGPILPKNPFHGIPQLPVLH 384

  Fly   257 N 257
            |
 Worm   385 N 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 6/21 (29%)
zf-H2C2_2 199..223 CDD:290200 11/23 (48%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..251 CDD:290200 6/27 (22%)
C2H2 Zn finger 242..262 CDD:275368 6/20 (30%)
zf-H2C2_2 255..279 CDD:290200 2/3 (67%)
C2H2 Zn finger 270..290 CDD:275368
B0310.2NP_508109.1 C2H2 Zn finger 308..330 CDD:275368 6/21 (29%)
zf-H2C2_2 323..347 CDD:290200 11/23 (48%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I4014
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.