DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:246 Identity:63/246 - (25%)
Similarity:90/246 - (36%) Gaps:74/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 FHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKH 248
            :.|..|...|.....|..|::||:||:|:.|..|.|.|.....|..|...||||:.:.|..|.|.
 Worm    88 YECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCNKA 152

  Fly   249 FRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEDEG----X 309
            |.|...|..|:.||:|.:|.||..|.|.|.....||.|:|||              ::.|    .
 Worm   153 FFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIH--------------QERGFSCQQ 203

  Fly   310 LGRMPLAAHHHQQQQHQHHHQQQQHQHHPP--------------------PPS------------ 342
            .||..|     :|.....||.:.:.:...|                    ||.            
 Worm   204 CGRSFL-----KQVMLDEHHLKCKGKPSSPIRSLLTPTMKAGLESAISIKPPQESMILSSETIAK 263

  Fly   343 -------QQQQQHIDQRGVTITTLPSATTVAQHHQQHQHIQDGSPHHHFNV 386
                   |||:.|   |....|.|.         :||::|.:.:.::..|:
 Worm   264 MAQKLLIQQQENH---RNALNTLLV---------KQHENILNNNNNNESNI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 5/19 (26%)
zf-H2C2_2 199..223 CDD:290200 11/23 (48%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
zf-H2C2_2 227..251 CDD:290200 10/23 (43%)
C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
zf-H2C2_2 255..279 CDD:290200 11/23 (48%)
C2H2 Zn finger 270..290 CDD:275368 8/19 (42%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/19 (26%)
zf-H2C2_2 102..127 CDD:290200 11/24 (46%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 7/19 (37%)
zf-H2C2_2 158..181 CDD:290200 10/22 (45%)
zf-C2H2 172..194 CDD:278523 9/21 (43%)
C2H2 Zn finger 174..194 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.