DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and Snai1

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_446257.1 Gene:Snai1 / 116490 RGDID:620758 Length:264 Species:Rattus norvegicus


Alignment Length:236 Identity:61/236 - (25%)
Similarity:109/236 - (46%) Gaps:28/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QQQHHQQQQQQSSGPPSVPPPPTELP--------LPFQMHLSGISAEAHSAAQAAAMAAAQAAAA 122
            ||.:.|.....:..||.|..|...||        :|....::..:.....:.:||.:.   :.:.
  Rat    32 QQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVQPVAWATLPLRESPRAAELT---SLSD 93

  Fly   123 QAAAAEQQQPPPPTSHLTHLTTHSPTTIHSEHYLANGHSEHPGEGN-----AAVGVGGAVREPE- 181
            :.:....|.|.||:...:..::.|.:::.:|.::|     .||.|.     |.:.|   .::|: 
  Rat    94 EDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIA-----FPGLGQLPKQLARLSV---AKDPQS 150

  Fly   182 -KPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNFC 245
             |.|:|..|::.:..|..|..|::.||  .|..|..|.|.|.:...|..|::.||||||::|:.|
  Rat   151 RKAFNCKYCNKEYLSLGALKMHIRSHT--LPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSCSHC 213

  Fly   246 PKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNH 286
            .:.|...|.|..|::.|:..|.::|..|.:.|.:.|.|:.|
  Rat   214 NRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 5/19 (26%)
zf-H2C2_2 199..223 CDD:290200 9/23 (39%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
zf-H2C2_2 227..251 CDD:290200 11/23 (48%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 255..279 CDD:290200 7/23 (30%)
C2H2 Zn finger 270..290 CDD:275368 6/17 (35%)
Snai1NP_446257.1 C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <177..>253 CDD:227381 27/77 (35%)
zf-C2H2 180..202 CDD:278523 6/21 (29%)
C2H2 Zn finger 182..202 CDD:275368 6/19 (32%)
zf-H2C2_2 195..218 CDD:290200 10/22 (45%)
zf-C2H2 208..230 CDD:278523 6/21 (29%)
C2H2 Zn finger 210..230 CDD:275368 6/19 (32%)
C2H2 Zn finger 238..255 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.