DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aef1 and si:dkey-210j14.3

DIOPT Version :9

Sequence 1:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_001342850.3 Gene:si:dkey-210j14.3 / 100003238 ZFINID:ZDB-GENE-131121-88 Length:350 Species:Danio rerio


Alignment Length:202 Identity:65/202 - (32%)
Similarity:87/202 - (43%) Gaps:57/202 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PPTELPLPFQMHLSG-ISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTT 149
            |..:.|.|.:..|.| ||...|:                  .|||..|          :||:||:
Zfish   201 PNVQQPQPEEESLHGTISTHGHN------------------TAEQNFP----------STHNPTS 237

  Fly   150 IHSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKC 214
            .          ||                  ||.|.|..|.|.|.:|:.|..|::.|:||||:.|
Zfish   238 F----------SE------------------EKRFECVFCQRTFNKLTYLKAHMRTHSGEKPFVC 274

  Fly   215 NVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQ 279
            .||.|.|.|.:.|..|.:.|:||:||:|..|.|.|.|.|:|..|::.||||||:.|..|.|.:..
Zfish   275 TVCGKRFAQKTYLRIHQRTHSGERPYSCMECGKSFAQKSSLNVHLRSHTGEKPYSCSECGKSYAY 339

  Fly   280 SSTLNNH 286
            ....|.|
Zfish   340 KQGFNTH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 7/19 (37%)
zf-H2C2_2 199..223 CDD:290200 12/23 (52%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
zf-H2C2_2 227..251 CDD:290200 11/23 (48%)
C2H2 Zn finger 242..262 CDD:275368 8/19 (42%)
zf-H2C2_2 255..279 CDD:290200 11/23 (48%)
C2H2 Zn finger 270..290 CDD:275368 5/17 (29%)
si:dkey-210j14.3XP_001342850.3 COG5048 227..>295 CDD:227381 31/105 (30%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
zf-H2C2_2 258..283 CDD:290200 12/24 (50%)
C2H2 Zn finger 274..294 CDD:275368 8/19 (42%)
zf-H2C2_2 286..311 CDD:290200 11/24 (46%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 314..339 CDD:290200 11/24 (46%)
C2H2 Zn finger 330..347 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.