Sequence 1: | NP_001262157.1 | Gene: | Aef1 / 40370 | FlyBaseID: | FBgn0005694 | Length: | 454 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001342850.3 | Gene: | si:dkey-210j14.3 / 100003238 | ZFINID: | ZDB-GENE-131121-88 | Length: | 350 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 65/202 - (32%) |
---|---|---|---|
Similarity: | 87/202 - (43%) | Gaps: | 57/202 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PPTELPLPFQMHLSG-ISAEAHSAAQAAAMAAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTT 149
Fly 150 IHSEHYLANGHSEHPGEGNAAVGVGGAVREPEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKC 214
Fly 215 NVCDKTFRQSSTLTNHLKIHTGEKPYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQ 279
Fly 280 SSTLNNH 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Aef1 | NP_001262157.1 | C2H2 Zn finger | 186..206 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 199..223 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 227..251 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 242..262 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 255..279 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 270..290 | CDD:275368 | 5/17 (29%) | ||
si:dkey-210j14.3 | XP_001342850.3 | COG5048 | 227..>295 | CDD:227381 | 31/105 (30%) |
C2H2 Zn finger | 246..266 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 258..283 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..311 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 314..339 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 330..347 | CDD:275368 | 5/17 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.960 |