DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and MRC2

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_006030.2 Gene:MRC2 / 9902 HGNCID:16875 Length:1479 Species:Homo sapiens


Alignment Length:251 Identity:55/251 - (21%)
Similarity:81/251 - (32%) Gaps:87/251 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FHGSAARAEINFEGPSPAH-----SQDTAAPTSRPKRRVYALCPPKFHRVGT---------DCYS 76
            |||..:      .|....|     :||..      |...:..||.|.:...|         .||.
Human   198 FHGCTS------TGREDGHLWCATTQDYG------KDERWGFCPIKSNDCETFWDKDQLTDSCYQ 250

  Fly    77 LVDQRS-SWLEAHFFCKDKNANL---TEPGKHADRKLRLFLQKQ----DALSGENDPIWLGATYD 133
            ...|.: ||.||...|:.:.|:|   ||            :.:|    ..|:|.:..:|:|....
Human   251 FNFQSTLSWREAWASCEQQGADLLSITE------------IHEQTYINGLLTGYSSTLWIGLNDL 303

  Fly   134 HHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISN--SQPLDNNCAIYDPSLKYRWSARPCSDKLRF 196
            ..:..||||           ..:...|:...|:  ..|.:.||.:........|..|.||..|.:
Human   304 DTSGGWQWS-----------DNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPY 357

  Fly   197 ICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILEPRENDRRYHRRVKAEDS 252
            :|:.|                    ||..|        ||...||..:.:|:.|.|
Human   358 VCKKK--------------------PNATA--------EPTPPDRWANVKVECEPS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/135 (24%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
MRC2NP_006030.2 RICIN 43..>127 CDD:238092
RICIN 46..161 CDD:214672
FN2 180..228 CDD:128373 8/41 (20%)
CLECT 247..361 CDD:153057 32/136 (24%)
CLECT 382..505 CDD:214480 2/4 (50%)
CLECT 521..644 CDD:214480
CLECT 669..809 CDD:214480
CLECT 829..951 CDD:214480
CLECT 972..1108 CDD:214480
CLECT 1137..1245 CDD:153057
CLECT 1261..1394 CDD:214480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1450..1479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.