DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec2i

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001276635.1 Gene:Clec2i / 93675 MGIID:2136650 Length:246 Species:Mus musculus


Alignment Length:184 Identity:41/184 - (22%)
Similarity:69/184 - (37%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCCQVFILALFAHTIAVEFHGSAARAE---INFEGPSPAHSQDTAAPTSRPKRRVYALCPPKF 67
            |::||...|:.|....||:....|..:.|   ||                     :.||.|...:
Mouse    82 KLYCCYGVIMVLTVAVIALSVALSTKKTEQIIIN---------------------KTYAACSKNW 125

  Fly    68 HRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIWLGATY 132
            ..||..|:.......:|..|..||..:.|.|   .:..:.:..:||::   ..|:.| .|:|...
Mouse   126 TGVGNKCFYFSGYPRNWTFAQAFCMAQEAQL---ARFDNEEELIFLKR---FKGDFD-CWIGLHR 183

  Fly   133 DHHNNRWQWSMS------------GR--NLSTDSFSRTDSAYVQLISNSQPLDN 172
            :...:.|:|:.:            ||  .||:|..|.:.| |:..:.....|:|
Mouse   184 ESSEHPWKWTNNTEYNNMNPILGVGRYAYLSSDRISSSRS-YINRMWICSKLNN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 25/113 (22%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec2iNP_001276635.1 CLECT_NK_receptors_like 121..233 CDD:153063 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.