DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klrb1b

DIOPT Version :10

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_085102.4 Gene:Klrb1b / 80782 MGIID:107539 Length:223 Species:Mus musculus


Alignment Length:154 Identity:33/154 - (21%)
Similarity:58/154 - (37%) Gaps:41/154 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKF--HRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQ-------DA 118
            ||..:  ||  ..|:.:....::|.|....|..|.|.|            |.:|.|       |:
Mouse    94 CPQDWLSHR--DKCFHVSQVSNTWKECRIDCDKKGATL------------LLIQDQEELRFLLDS 144

  Fly   119 LSGENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKY 183
            :..:.:..|:|.:|...:..|:| ::|...::|....|....          :.:||.....   
Mouse   145 IKEKYNSFWIGLSYTLTDMNWKW-INGTAFNSDVLKITGVTE----------NGSCAAISGE--- 195

  Fly   184 RWSARPCSDKLRFICQ----HKMP 203
            :.::..||...|:|||    |:.|
Mouse   196 KVTSEGCSSDNRWICQKELNHETP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 27/136 (20%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
Klrb1bNP_085102.4 ITIM motif 6..11
LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 30/145 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.