Sequence 1: | NP_001246866.1 | Gene: | rgn / 40368 | FlyBaseID: | FBgn0261258 | Length: | 808 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001078874.1 | Gene: | Klrb1 / 689817 | RGDID: | 1587563 | Length: | 214 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 76/196 - (38%) | Gaps: | 26/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 CQVFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPKRRVYALCPPKFHRVGTDC 74
Fly 75 YSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIWLGATYDHHNNRW 139
Fly 140 QWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQHKMPK 204
Fly 205 V 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rgn | NP_001246866.1 | CLECT | 74..200 | CDD:153057 | 28/125 (22%) |
GBP_C | <414..508 | CDD:303769 | |||
TPH | 421..756 | CDD:290579 | |||
coiled coil | 483..494 | CDD:293879 | |||
Klrb1 | NP_001078874.1 | Neurensin | 20..>69 | CDD:291588 | 7/27 (26%) |
CLECT_NK_receptors_like | 91..209 | CDD:153063 | 31/136 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166345312 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |