Sequence 1: | NP_001246866.1 | Gene: | rgn / 40368 | FlyBaseID: | FBgn0261258 | Length: | 808 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094489.2 | Gene: | LOC689757 / 689757 | RGDID: | 1588731 | Length: | 262 | Species: | Rattus norvegicus |
Alignment Length: | 216 | Identity: | 48/216 - (22%) |
---|---|---|---|
Similarity: | 74/216 - (34%) | Gaps: | 60/216 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KMWCCQVFILALFAHTIAVEFH-------------GSAARAEINFEGPSPAHSQDTAAPTSRPKR 57
Fly 58 RVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSG 121
Fly 122 ENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPL--DNNCAIYDPSLKYR 184
Fly 185 WS----ARP--CSDKLRFICQ 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rgn | NP_001246866.1 | CLECT | 74..200 | CDD:153057 | 32/135 (24%) |
GBP_C | <414..508 | CDD:303769 | |||
TPH | 421..756 | CDD:290579 | |||
coiled coil | 483..494 | CDD:293879 | |||
LOC689757 | NP_001094489.2 | CLECT_NK_receptors_like | 140..253 | CDD:153063 | 32/137 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166345302 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |