DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and LOC689757

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001094489.2 Gene:LOC689757 / 689757 RGDID:1588731 Length:262 Species:Rattus norvegicus


Alignment Length:216 Identity:48/216 - (22%)
Similarity:74/216 - (34%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCCQVFILALFAHTIAVEFH-------------GSAARAEINFEGPSPAHSQDTAAPTSRPKR 57
            |.:||...::.:.|..|.|...             .:...|.||  ..|.|...:|:        
  Rat    83 KRYCCYGGVITVVAIAIVVPLSVTLSVKQMEQTSINNTFAASIN--NTSAASINNTS-------- 137

  Fly    58 RVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSG 121
               |.||..:...|..|:...:..|:|..:..||..:.|.|.    ..|.:..| ||::....||
  Rat   138 ---AACPSNWTEYGNKCFYFSEYTSNWTFSKDFCAAQGAELA----RFDTEEELNFLKRYKGSSG 195

  Fly   122 ENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPL--DNNCAIYDPSLKYR 184
                .|:|...:...:.|:|        ||     ::.|..|:    |:  |..|......|...
  Rat   196 ----YWIGLHRESSEHPWKW--------TD-----NTQYNNLV----PIRGDGQCGFLSDQLNIS 239

  Fly   185 WS----ARP--CSDKLRFICQ 199
            .|    .||  ||...::|.|
  Rat   240 SSRVYVERPWICSKPKKYISQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/135 (24%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
LOC689757NP_001094489.2 CLECT_NK_receptors_like 140..253 CDD:153063 32/137 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.