DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klrb1c

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001078872.1 Gene:Klrb1c / 683758 RGDID:1583336 Length:217 Species:Rattus norvegicus


Alignment Length:200 Identity:43/200 - (21%)
Similarity:69/200 - (34%) Gaps:24/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCCQVFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPKRRVYALCPPKFHRV 70
            |:.|..:.:|.|....::|.......:..|  |..|.|..::...||.   |.....||..:...
  Rat    42 KLGCATLILLLLTLIGLSVFVRFLVQKPLI--EKCSMAAQENGTEPTG---RSAILECPRHWQPH 101

  Fly    71 GTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIWLGATYDHH 135
            ...|..:......|.|....|..|.|.|.......:.|.     .|:.|.|.....::|..|...
  Rat   102 RNKCLIISQISRPWAEGLVACSMKEATLLIIENEEELKF-----VQNILKGRQQLFFIGLNYVQT 161

  Fly   136 NNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQH 200
            ...|:| ::|..|..:....|.|          .::|:||:...:..:..|   ||....:|||.
  Rat   162 EMTWKW-INGSVLKPNILRITGS----------EVENSCALISHTEVFSDS---CSSDNHWICQK 212

  Fly   201 KMPKV 205
            .:..|
  Rat   213 TLKHV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 27/125 (22%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klrb1cNP_001078872.1 LCK-binding motif. /evidence=ECO:0000255 31..34
CLECT_NK_receptors_like 94..212 CDD:153063 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.