DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Reg4

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_080604.2 Gene:Reg4 / 67709 MGIID:1914959 Length:157 Species:Mus musculus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:57/148 - (38%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDA------LSG 121
            |.|.:....:.||....:..:|..|...|:...     .|.|    |...|.:::|      ::|
Mouse    29 CAPGWFYYRSHCYGYFRKLRNWSHAELECQSYG-----NGSH----LASVLNQKEASVISKYITG 84

  Fly   122 --ENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKY- 183
              .|.|:|:|.........|||:....||......||.|.           ..:||..:|..|: 
Mouse    85 YQRNLPVWIGLHDPQKKQLWQWTDGSTNLYRRWNPRTKSE-----------ARHCAEMNPKDKFL 138

  Fly   184 RWSARPCSDKLRFICQHK 201
            .|:...|:::..|:|::|
Mouse   139 TWNKNGCANRQHFLCKYK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 31/134 (23%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Reg4NP_080604.2 CLECT_REG-1_like 29..155 CDD:153064 33/145 (23%)
Carbohydrate-binding. /evidence=ECO:0000250 97..102 0/4 (0%)
Carbohydrate-binding. /evidence=ECO:0000250 134..136 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.