DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and REG1B

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_006498.1 Gene:REG1B / 5968 HGNCID:9952 Length:166 Species:Homo sapiens


Alignment Length:162 Identity:38/162 - (23%)
Similarity:68/162 - (41%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNA-NLTEPGKHADRK 108
            ||...:.|..|..|:  .||...:...:.||...:...:|::|..:|::.|: ||......|:..
Human    20 SQGQESQTELPNPRI--SCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGA 82

  Fly   109 LRLFLQKQDALSGENDPIWLGATYDHHNNRWQWS----MSGRNLSTDSFSRTDSAYVQLISNSQP 169
            ....|.|:.:....|  :|:|......|.||.||    :|.::..|.|.|..::.|...::    
Human    83 FVASLIKESSTDDSN--VWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLT---- 141

  Fly   170 LDNNCAIYDPSLKYRWSARPCSDKLRFICQHK 201
               :|:.:.     :|....|..|..|:|:.|
Human   142 ---SCSGFK-----KWKDESCEKKFSFVCKFK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 30/130 (23%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
REG1BNP_006498.1 CLECT 36..164 CDD:413318 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.