DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and REG1A

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:166 Identity:45/166 - (27%)
Similarity:72/166 - (43%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AHSQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNA-NLTEPGKHAD 106
            :.||...|.|..|:.|:  .||...:...:.||...:.|.:|::|..:|::.|: ||......|:
Human    18 SQSQGQEAQTELPQARI--SCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAE 80

  Fly   107 RKLRLFLQKQDALSGEND-PIWLGATYDHHNNRWQWSMSGRNLSTDSF-----SRTDSAYVQLIS 165
            ......|.|:   ||.:| .:|:|......|.||.|| ||..:|..|:     |..:..|...::
Human    81 GAFVASLIKE---SGTDDFNVWIGLHDPKKNRRWHWS-SGSLVSYKSWGIGAPSSVNPGYCVSLT 141

  Fly   166 NSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQHK 201
            :|....            :|...||.||..|:|:.|
Human   142 SSTGFQ------------KWKDVPCEDKFSFVCKFK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 36/132 (27%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
REG1ANP_002900.2 CLECT 36..164 CDD:321932 38/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5878
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.