DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and si:dkey-241l7.2

DIOPT Version :10

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001231964.1 Gene:si:dkey-241l7.2 / 569235 ZFINID:ZDB-GENE-041014-240 Length:153 Species:Danio rerio


Alignment Length:134 Identity:23/134 - (17%)
Similarity:51/134 - (38%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIWLGATYDHH 135
            |:.|:....:..:|:.|...|:....||.......:....|      :|...:...|:|......
Zfish    35 GSRCFRFFSRSVNWVTAERNCQSLGGNLASVHDQVENDFLL------SLVPGSTRCWIGGHDGEQ 93

  Fly   136 NNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFIC-Q 199
            :.:|.||      ....:..|:....:..|.|:    :|...:.:....|:.:.||.::.::| :
Zfish    94 DGQWLWS------DGSVYGYTNWCSGEPSSGSE----HCLEINWTSDRCWNNQGCSTRMGYLCAK 148

  Fly   200 HKMP 203
            .::|
Zfish   149 RRVP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 21/126 (17%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
si:dkey-241l7.2NP_001231964.1 CLECT 27..146 CDD:214480 21/126 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.