DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec1b

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_064369.1 Gene:Clec1b / 56760 MGIID:1913287 Length:229 Species:Mus musculus


Alignment Length:143 Identity:29/143 - (20%)
Similarity:54/143 - (37%) Gaps:33/143 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIW 127
            |..|:...|..||....:..:|.|:..:|.::||.|.:....:  .|....::..::.      |
Mouse   102 CATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQS--TLDYIAERITSVR------W 158

  Fly   128 LGATYDHHNNRWQWSMS------GRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWS 186
            :|.:..:....|.|..|      |.|||.::....:.||:          :|..|:..|      
Mouse   159 IGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYL----------HNGKIHPAS------ 207

  Fly   187 ARPCSDKLRFICQ 199
               |.::...||:
Mouse   208 ---CKERHYLICE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 26/132 (20%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec1bNP_064369.1 CLECT_NK_receptors_like 102..218 CDD:153063 29/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.