DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec7a

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_064392.2 Gene:Clec7a / 56644 MGIID:1861431 Length:244 Species:Mus musculus


Alignment Length:215 Identity:46/215 - (21%)
Similarity:74/215 - (34%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCQVFILALFAHTIAVEFHGSAARAE--INF----------------EGPSPAHSQDTAAPTSRP 55
            |..|.::|.....:|...|.|....|  .||                |..:|:.:..|....|:|
Mouse    54 CFVVVVVAAVLGALAFWRHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQP 118

  Fly    56 KRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALS 120
                   |.|.:...|..||......:||..:...|....|:|.   |..:.|...|::.|.: |
Mouse   119 -------CLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLL---KIDNSKEFEFIESQTS-S 172

  Fly   121 GENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQP---LDNNCAIYDPSLK 182
            ...:..|:|.:.:.....|.|. .|.....:||.         :.|:.|   |.:||.....|..
Mouse   173 HRINAFWIGLSRNQSEGPWFWE-DGSAFFPNSFQ---------VRNTAPQESLLHNCVWIHGSEV 227

  Fly   183 YRWSARPCSDKLRFICQHKM 202
            |.   :.|:.....||:.::
Mouse   228 YN---QICNTSSYSICEKEL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 29/128 (23%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec7aNP_064392.2 ITAM-like 15..18
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..113 8/41 (20%)
CLECT_NK_receptors_like 119..242 CDD:153063 32/139 (23%)
(1,3-beta-D-glucosyl)n binding. /evidence=ECO:0000305|PubMed:17473009, ECO:0007744|PDB:2CL8 145..152 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.