DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and si:ch211-282j17.10

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001026840.1 Gene:si:ch211-282j17.10 / 557030 ZFINID:ZDB-GENE-041210-283 Length:368 Species:Danio rerio


Alignment Length:188 Identity:43/188 - (22%)
Similarity:80/188 - (42%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CYSL------VDQRSSWLEAHFFCKDKNANLTE-PGKHADRKLRLFLQKQDALSGENDPIWLGAT 131
            ||::      |:|..:|.:|..:|:..:.:|.. ..::.:::|..|:..::: ||  ..:|:|..
Zfish   129 CYNMSRGLVFVNQMMTWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNS-SG--SAVWIGLF 190

  Fly   132 YDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDK-LR 195
            .|    .||||    :.|..||...|:...   :|....| ||.:...:.:..|:..||.:: :.
Zfish   191 RD----SWQWS----DQSNSSFRYWDTGEP---NNGGEYD-NCTVIGANAQRGWADVPCDNRQIP 243

  Fly   196 FICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILEPRENDRRYHRRVKAEDSD 253
            |:|......|...|.     .|:......:.|.|.|..::..|..||....||...::
Zfish   244 FVCHEDKLIVIQQNL-----SWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLASTE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/133 (24%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
si:ch211-282j17.10NP_001026840.1 CLECT 24..131 CDD:295302 1/1 (100%)
CLECT_1 134..247 CDD:153072 29/127 (23%)
CLECT 253..365 CDD:153057 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.