DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and si:dkey-88n24.7

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001314983.1 Gene:si:dkey-88n24.7 / 555676 ZFINID:ZDB-GENE-041014-91 Length:369 Species:Danio rerio


Alignment Length:196 Identity:43/196 - (21%)
Similarity:81/196 - (41%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CYSL------VDQRSSWLEAHFFCKDKNANLTE-PGKHADRKLRLFLQKQDALSGENDPIWLGAT 131
            |:.:      |:|..:|..|..:|:..:.:|.. ..::.:::|..|:..::: ||  ..:|:|..
Zfish   124 CFQMSGGLVFVNQLMNWRAAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNS-SG--SAVWIGLF 185

  Fly   132 YDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNN------CAIYDPSLKYRWSARPC 190
            .|    .||||    :.|..||        :..|..:|  ||      ||:.....:..|:..||
Zfish   186 RD----TWQWS----DQSNSSF--------RYWSTGEP--NNVGGNEDCAMISQYPQGLWNDIPC 232

  Fly   191 SDKLRFICQHKMPKVSGPNRYKIYNR---WNATYPNEQANEVVLEILEPRENDRRYHRRVKAEDS 252
            ..:..|:| |:...|...::..:..:   |:......:.|.|.|..::..|..||....||...:
Zfish   233 HFQFPFVC-HQDFFVLHKDKLIVIQQNLSWSEALRYCRQNHVDLVSVQSVEMQRRVMNVVKLAST 296

  Fly   253 D 253
            :
Zfish   297 E 297

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/138 (23%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879